PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010912708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 306aa    MW: 34407.4 Da    PI: 8.1016
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010912708.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.2e-5281371129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                     +ppGfrFhPt+eel+ +yLkkkv+ +k++l evi+e+d +k+ePwdL++  +       ++ewyfFs++ +ky+tg+r+nrat++g+Wkatg+dk
  XP_010912708.1   8 VPPGFRFHPTEEELLLYYLKKKVSFEKFDL-EVIREIDFNKIEPWDLQErcR--IgcaAQNEWYFFSHKGRKYPTGSRTNRATNAGFWKATGRDK 99 
                     69****************************.99**************96342..3233678********************************** PP

             NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ s +++ +g++ktLvfy+grap+g+ktdW+mheyrle
  XP_010912708.1 100 SIRS-THNRIGMRKTLVFYHGRAPHGQKTDWIMHEYRLE 137
                     ****.8889****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-585162IPR003441NAC domain
PROSITE profilePS5100556.2188162IPR003441NAC domain
PfamPF023655.9E-279136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MASSNSGVPP GFRFHPTEEE LLLYYLKKKV SFEKFDLEVI REIDFNKIEP WDLQERCRIG  60
CAAQNEWYFF SHKGRKYPTG SRTNRATNAG FWKATGRDKS IRSTHNRIGM RKTLVFYHGR  120
APHGQKTDWI MHEYRLEEDL SGDAADGSGA EGGWVVCRVF KKKYFLKAGS EGGPSQGSEN  180
NHMNTTASHD QPRPLSSQYI HPLPVYYSPQ LPLQSYSHGQ VQDLLSNHRP TAGYDFSVLP  240
GADSSAMVKG AYEGELEGIR EQSLNDWTVL DGIDRRFGSA GGAAVQQMNQ ISGQRGGEMD  300
LWGYGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-50816320169NAC domain-containing protein 19
3swm_B2e-50816320169NAC domain-containing protein 19
3swm_C2e-50816320169NAC domain-containing protein 19
3swm_D2e-50816320169NAC domain-containing protein 19
3swp_A2e-50816320169NAC domain-containing protein 19
3swp_B2e-50816320169NAC domain-containing protein 19
3swp_C2e-50816320169NAC domain-containing protein 19
3swp_D2e-50816320169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912708.10.0PREDICTED: protein BEARSKIN1-like
SwissprotQ9SV874e-98BRN2_ARATH; Protein BEARSKIN2
TrEMBLM0S5F51e-133M0S5F5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P05640_0011e-133(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-85NAC domain containing protein 70